Abbiotec, LLC
7955 Dunbrook Road, Suite B
San Diego, CA 92126
Phone: 1 858 586 0500
Toll Free: 1 800 854 7453
Fax: 1 858 586 6252
Email Us
Catalog Number350077 Unit1 mg Price$368.00 |
Beta-amyloid production results from cleavage in the extracellular domain of APP by the beta-secretase (BACE1) , which results in the production of the APP C-terminal fragment C99. This fragment is further cleaved by the gamma-secretase at residues 40-42 to produce beta-amyloid 40 and 42 peptides. Beta-amyloid aggregation and neuritic plaque formation are pathologic hallmarks of Alzheimer disease. This peptide corresponds to the rat beta-amyloid 1-40 peptide.
FormatEach vial contains 1 mg of lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt. Data and Images |
Product CitationsRecommended Products 350079 Beta Amyloid [25-35] Peptide Alternate NamesBeta-amyloid protein 40; Beta-APP40; P3(40); Amyloid beta A4 protein; APP; ABPP; Alzheimer disease amyloid protein; Cerebral vascular amyloid peptide; CVAP; Protease nexin-II; PN-II; APPI; PreA4 Accession No.MW4233.81 g/mol SequenceRat: H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH or H-DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH CompositionC190H291N51O57S1 PurityPurity > 95% by HPLC SolubilityDistilled water for a solution up to 2 mg/ml, otherwise we recommend using acetonitrile. StorageStore at -20°C. The product is hygroscopic and must be protected from light. Product is guaranteed one year from the date of shipment. Following reconstitution, aliquot and store at -20°C. |
For research use only, not for diagnostic or therapeutic procedures.