Abbiotec, LLC
7985 Dunbrook Road, Suite A
San Diego, CA 92126
Phone: 1 858 586 0500
Toll Free: 1 800 854 7453
Fax: 1 858 586 6252
Email Us
Catalog Number350171 Unit1 mg Price$436.00 FormatEach vial contains 1 mg of lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt. |
DescriptionExendins are secreted by lizard venom gland. They have a VIP/secretin-like biological activity when binding to the exendin receptor. Exedin-4 (named Byetta, Amylin/Eli Lilly) is used for the treatment of type 2 diabetes by enhancing insulin secretion. Recommended ProductsAccession No.MW4186.03 g/mol SequenceH-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 or H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 CompositionC184H282N50O60S1 PurityPurity > 95% by HPLC SolubilityDistilled water for a solution up to 2 mg/ml, otherwise we recommend using acetonitrile. StorageStore at -20°C. The product is hygroscopic and must be protected from light. Product is guaranteed one year from the date of shipment. Following reconstitution, aliquot and store at -20°C. |
| Hormones, Metabolic Disorders | |
For research use only, not for diagnostic or therapeutic procedures.